General Information

  • ID:  hor004132
  • Uniprot ID:  Q9EP95(24-111)
  • Protein name:  Resistin-like alpha
  • Gene name:  Retnla
  • Organism:  Mus musculus (Mouse)
  • Family:  Resistin/FIZZ family
  • Source:  animal
  • Expression:  Highest levels in adipose tissue.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS
  • Length:  88(24-111)
  • Propeptide:  MKTTTCSLLICISLLQLMVPVNTDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS
  • Signal peptide:  MKTTTCSLLICISLLQLMVPVNT
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays a role in pulmonary vascular remodeling
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  32-85; 44-84; 53-70; 55-72; 59-74
  • Structure ID:  AF-Q9EP95-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004132_AF2.pdbhor004132_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 1098287 Formula: C399H640N108O131S12
Absent amino acids: H Common amino acids: TC
pI: 4.54 Basic residues: 6
Polar residues: 39 Hydrophobic residues: 28
Hydrophobicity: 11.82 Boman Index: -8777
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 74.32
Instability Index: 5590 Extinction Coefficient cystines: 18615
Absorbance 280nm: 213.97

Literature

  • PubMed ID:  20582166
  • Title:  Hypoxia-induced Mitogenic Factor (HIMF/FIZZ1/RELM Alpha) Recruits Bone Marrow-Derived Cells to the Murine Pulmonary Vasculature